SCOPe 2.07: Domain d3vrza3: 3vrz A:250-531

Lineage for d3vrza3 (3vrz A:250-531)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)

8. Domain d3vrza3: 3vrz A:250-531 [218054]
   Other proteins in same PDB: d3vrza1, d3vrza2, d3vrza4, d3vrzb1, d3vrzb2, d3vrzb4
   automated match to d1qcfa3
   complexed with ca, cl, vrz

Details for d3vrza3

PDB Entry: 3vrz, 2.22 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 1-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]-3-benzylurea

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vrza3:

Sequence, based on SEQRES records:

>d3vrza3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records):

>d3vrza3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik
sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr
peerptfeyiqsvlddfytatesqyeeip

Timeline for d3vrza3:

• d3vrza3 first appeared in SCOPe 2.03
  
• d3vrza3 appears in SCOPe 2.06
  
• d3vrza3 appears in the current release, SCOPe 2.08