Lineage for d3vrya3 (3vry A:250-531)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673092Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1673093Species Human (Homo sapiens) [TaxId:9606] [56152] (19 PDB entries)
  8. 1673106Domain d3vrya3: 3vry A:250-531 [218048]
    Other proteins in same PDB: d3vrya1, d3vrya2, d3vryb1, d3vryb2
    automated match to d1qcfa3
    complexed with b43, ca, cl

Details for d3vrya3

PDB Entry: 3vry (more details), 2.48 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 4-Amino-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl-cyclopentane
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vrya3:

Sequence, based on SEQRES records: (download)

>d3vrya3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d3vrya3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvifpikwtapeainfgsfti
ksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwkn
rpeerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d3vrya3:

Click to download the PDB-style file with coordinates for d3vrya3.
(The format of our PDB-style files is described here.)

Timeline for d3vrya3: