SCOPe 2.07: Domain d3vqpb_: 3vqp B:

Lineage for d3vqpb_ (3vqp B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)

8. Domain d3vqpb_: 3vqp B: [218040]
   automated match to d2itga_
   protein/DNA complex; protein/RNA complex; complexed with cd, cl, dbj, so4

Details for d3vqpb_

PDB Entry: 3vqp, 2.1 Å

PDB Description: HIV-1 IN core domain in complex with 2,3-dihydro-1,4-benzodioxin-5-ylmethanol

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3vqpb_:

Sequence, based on SEQRES records:

>d3vqpb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records):

>d3vqpb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqeiesmnkelkkiigqvrdqaehlktavqmavfihnhkrk
ggiggysagerivdiiatdi

Timeline for d3vqpb_:

• d3vqpb_ first appeared in SCOPe 2.03
  
• d3vqpb_ appears in SCOPe 2.06
  
• d3vqpb_ appears in the current release, SCOPe 2.08