Lineage for d3vpqa2 (3vpq A:77-204)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327357Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
  8. 2327359Domain d3vpqa2: 3vpq A:77-204 [218012]
    Other proteins in same PDB: d3vpqa1
    automated match to d1m0ua1
    complexed with 1pe, gsh, peg, pgo

Details for d3vpqa2

PDB Entry: 3vpq (more details), 1.7 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathione
PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vpqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpqa2 a.45.1.0 (A:77-204) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei
ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv
daaprtel

SCOPe Domain Coordinates for d3vpqa2:

Click to download the PDB-style file with coordinates for d3vpqa2.
(The format of our PDB-style files is described here.)

Timeline for d3vpqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vpqa1