Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries) |
Domain d3vpqa2: 3vpq A:77-204 [218012] Other proteins in same PDB: d3vpqa1 automated match to d1m0ua1 complexed with 1pe, gsh, peg, pgo |
PDB Entry: 3vpq (more details), 1.7 Å
SCOPe Domain Sequences for d3vpqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpqa2 a.45.1.0 (A:77-204) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv daaprtel
Timeline for d3vpqa2: