Lineage for d3vl9a_ (3vl9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390502Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2390503Domain d3vl9a_: 3vl9 A: [217912]
    automated match to d3vl8a_

Details for d3vl9a_

PDB Entry: 3vl9 (more details), 1.2 Å

PDB Description: crystal structure of xeg-xyloglucan
PDB Compounds: (A:) Xyloglucan-specific endo-beta-1,4-glucanase A

SCOPe Domain Sequences for d3vl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vl9a_ b.29.1.0 (A:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
lqrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggss
svksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimv
wlaalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndff
tylvdnegvsdelylttleagtepftgsnakltvseysisie

SCOPe Domain Coordinates for d3vl9a_:

Click to download the PDB-style file with coordinates for d3vl9a_.
(The format of our PDB-style files is described here.)

Timeline for d3vl9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vl9b_