Lineage for d3vk9a1 (3vk9 A:1-86)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488189Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries)
  8. 2488193Domain d3vk9a1: 3vk9 A:1-86 [217873]
    Other proteins in same PDB: d3vk9a2, d3vk9b2, d3vk9c2, d3vk9d2
    automated match to d1r5aa2
    complexed with gol

Details for d3vk9a1

PDB Entry: 3vk9 (more details), 2 Å

PDB Description: Crystal structure of delta-class glutathione transferase from silkmoth
PDB Compounds: (A:) Glutathione S-transferase delta

SCOPe Domain Sequences for d3vk9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk9a1 c.47.1.0 (A:1-86) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mtidlyyvpgsapcravlltakalnlnlnlklvdlhhgeqlkpeylklnpqhtvptlvdd
glsiwesraiitylvnkyakgsslyp

SCOPe Domain Coordinates for d3vk9a1:

Click to download the PDB-style file with coordinates for d3vk9a1.
(The format of our PDB-style files is described here.)

Timeline for d3vk9a1: