Lineage for d3uapa1 (3uap A:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487889Species Methylococcus capsulatus [TaxId:243233] [226241] (2 PDB entries)
  8. 2487891Domain d3uapa1: 3uap A:1-80 [217263]
    Other proteins in same PDB: d3uapa2, d3uapa3
    automated match to d2pmta2
    complexed with gol

Details for d3uapa1

PDB Entry: 3uap (more details), 2.8 Å

PDB Description: crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3uapa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uapa1 c.47.1.0 (A:1-80) automated matches {Methylococcus capsulatus [TaxId: 243233]}
mklyyfpgacslaphivlreagldfelenvdlgtkktgsgadflqvnpkgyvpalqlddg
qvltedqvilqyladlkpes

SCOPe Domain Coordinates for d3uapa1:

Click to download the PDB-style file with coordinates for d3uapa1.
(The format of our PDB-style files is described here.)

Timeline for d3uapa1: