SCOP 1.67: Domain d1itbb3: 1itb B:205-315

Lineage for d1itbb3 (1itb B:205-315)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)
   duplication: tandem repeat of 3 domains

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (3 PDB entries)

8. Domain d1itbb3: 1itb B:205-315 [21722]
   Other proteins in same PDB: d1itba_

Details for d1itbb3

PDB Entry: 1itb, 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta

SCOP Domain Sequences for d1itbb3:

Sequence; same for both SEQRES and ATOM records:

>d1itbb3 b.1.1.4 (B:205-315) Type-1 interleukin-1 receptor {Human (Homo sapiens)}
kptrpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysv
enpankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliypvt

Timeline for d1itbb3:

• d1itbb3 first appeared (with stable ids) in SCOP 1.55
  
• d1itbb3 appears in SCOP 1.65
  
• d1itbb3 appears in SCOP 1.69
  
• d1itbb3 appears in the current release, SCOPe 2.08