Lineage for d1bqsa2 (1bqs A:91-209)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54423Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)
  7. 54424Species Human (Homo sapiens) [TaxId:9606] [49169] (1 PDB entry)
  8. 54426Domain d1bqsa2: 1bqs A:91-209 [21705]

Details for d1bqsa2

PDB Entry: 1bqs (more details), 2.2 Å

PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)

SCOP Domain Sequences for d1bqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqsa2 b.1.1.4 (A:91-209) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens)}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlhsptspe

SCOP Domain Coordinates for d1bqsa2:

Click to download the PDB-style file with coordinates for d1bqsa2.
(The format of our PDB-style files is described here.)

Timeline for d1bqsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqsa1