Lineage for d3tqqa2 (3tqq A:206-314)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404122Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2404123Protein automated matches [227053] (7 species)
    not a true protein
  7. 2404133Species Coxiella burnetii [TaxId:777] [226216] (1 PDB entry)
  8. 2404134Domain d3tqqa2: 3tqq A:206-314 [216989]
    Other proteins in same PDB: d3tqqa1
    automated match to d1fmta1
    complexed with k

Details for d3tqqa2

PDB Entry: 3tqq (more details), 2 Å

PDB Description: structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3tqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqqa2 b.46.1.0 (A:206-314) automated matches {Coxiella burnetii [TaxId: 777]}
iqkqealidwrksaveiarqvrafnptpiaftyfegqpmriwratvvdektdfepgvlvd
adkkgisiaagsgilrlhqlqlpgkrvcsagdfinahgdklipgktvfg

SCOPe Domain Coordinates for d3tqqa2:

Click to download the PDB-style file with coordinates for d3tqqa2.
(The format of our PDB-style files is described here.)

Timeline for d3tqqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqqa1