Lineage for d3tl6e_ (3tl6 E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2496816Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [189769] (2 PDB entries)
  8. 2496827Domain d3tl6e_: 3tl6 E: [216871]
    Other proteins in same PDB: d3tl6d2
    automated match to d3u40a_
    complexed with so4

Details for d3tl6e_

PDB Entry: 3tl6 (more details), 2.65 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase from Entamoeba histolytica
PDB Compounds: (E:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3tl6e_:

Sequence, based on SEQRES records: (download)

>d3tl6e_ c.56.2.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcygsgekmtaeerrtkftqmmevalsla

Sequence, based on observed residues (ATOM records): (download)

>d3tl6e_ c.56.2.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcyftqmmevalsla

SCOPe Domain Coordinates for d3tl6e_:

Click to download the PDB-style file with coordinates for d3tl6e_.
(The format of our PDB-style files is described here.)

Timeline for d3tl6e_: