Lineage for d3thab_ (3tha B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337943Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1337944Protein automated matches [190292] (20 species)
    not a true protein
  7. 1337958Species Campylobacter jejuni [TaxId:192222] [194783] (2 PDB entries)
  8. 1337961Domain d3thab_: 3tha B: [216822]
    automated match to d1wdwa1

Details for d3thab_

PDB Entry: 3tha (more details), 2.37 Å

PDB Description: Tryptophan synthase subunit alpha from Campylobacter jejuni.
PDB Compounds: (B:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d3thab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3thab_ c.1.2.0 (B:) automated matches {Campylobacter jejuni [TaxId: 192222]}
amvdfrkfykenanvaytvlgypnlqtseaflqrldqspidilelgvaysdpiadgeiia
daakialdqgvdihsvfellariktkkalvfmvyynlifsyglekfvkkakslgicaliv
pelsfeesddlikecerynialitlvsvttpkervkklvkhakgfiyllasigitgtksv
eeailqdkvkeirsftnlpifvgfgiqnnqdvkrmrkvadgvivgtsivkcfkqgnldii
mkdieeifk

SCOPe Domain Coordinates for d3thab_:

Click to download the PDB-style file with coordinates for d3thab_.
(The format of our PDB-style files is described here.)

Timeline for d3thab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3thaa_