Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d3teha_: 3teh A: [216772] Other proteins in same PDB: d3tehb1, d3tehb2, d3tehb3, d3tehb4, d3tehb5, d3tehb6 automated match to d1eiya2 protein/RNA complex; complexed with dah |
PDB Entry: 3teh (more details), 2.85 Å
SCOPe Domain Sequences for d3teha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3teha_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d3teha_: