Lineage for d3tb4a_ (3tb4 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361309Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361310Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1361344Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1361345Protein automated matches [190499] (13 species)
    not a true protein
  7. 1361400Species Vibrio cholerae [TaxId:666] [226451] (2 PDB entries)
  8. 1361402Domain d3tb4a_: 3tb4 A: [216711]
    automated match to d3r77a_
    complexed with bog, ca, edo, peg, pge

Details for d3tb4a_

PDB Entry: 3tb4 (more details), 1.35 Å

PDB Description: crystal structure of the isc domain of vibb
PDB Compounds: (A:) Vibriobactin-specific isochorismatase

SCOPe Domain Sequences for d3tb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tb4a_ c.33.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
ipkiasyplpvslptnkvdwridasravllihdmqeyfvhyfdsqaepipslikhiqqlk
ahakqagipvvytaqpanqdpaerallsdfwgpglseetaiiaplapesgdvqltkwrys
afkksplldwlretgrdqliitgvyahigilstaldafmfdiqpfvigdgvadfslsdhe
fslryisgrtgavkstqqacleiaa

SCOPe Domain Coordinates for d3tb4a_:

Click to download the PDB-style file with coordinates for d3tb4a_.
(The format of our PDB-style files is described here.)

Timeline for d3tb4a_: