SCOPe 2.07: Domain d3t95a_: 3t95 A:

Lineage for d3t95a_ (3t95 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [226264] (2 PDB entries)

8. Domain d3t95a_: 3t95 A: [216707]
   automated match to d1tm2a_
   complexed with pav

Details for d3t95a_

PDB Entry: 3t95, 1.75 Å

PDB Description: crystal structure of lsrb from yersinia pestis complexed with autoinducer-2

PDB Compounds: (A:) Autoinducer 2-binding protein lsrB

SCOPe Domain Sequences for d3t95a_:

Sequence; same for both SEQRES and ATOM records:

>d3t95a_ c.93.1.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
aeriafipklvgvgfftsggkgavdagkalgvdvtydgptepsvsgqvqlinnfvnqgyn
aivvsavspdglcpalkramqrgvkiltwdsdtkpecrsvyinqgtpnqlgsmlvdmaan
qvkkeqakvaffyssptvtdqnqwvneakkkiqqehpgweivttqfgyndatkslqtaeg
ilkayadldaiiapdanalpaaaqaaenlkranvaivgfstpnvmrpyvergtvkefglw
dvvnqgkisvyvanemlkkgdlnvgdkidipnigvvevspnrvqgydyeakgngivllpq
rviftkeniskydf

Timeline for d3t95a_:

• d3t95a_ first appeared in SCOPe 2.03
  
• d3t95a_ appears in SCOPe 2.06
  
• d3t95a_ appears in the current release, SCOPe 2.08