Lineage for d1wiob4 (1wio B:292-363)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 222049Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 222059Protein CD4 [49149] (2 species)
  7. 222060Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries)
  8. 222074Domain d1wiob4: 1wio B:292-363 [21670]
    Other proteins in same PDB: d1wioa1, d1wioa2, d1wiob1, d1wiob2

Details for d1wiob4

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form

SCOP Domain Sequences for d1wiob4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiob4 b.1.1.3 (B:292-363) CD4 {Human (Homo sapiens)}
mratqlqknltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsg
qvllesnikvlp

SCOP Domain Coordinates for d1wiob4:

Click to download the PDB-style file with coordinates for d1wiob4.
(The format of our PDB-style files is described here.)

Timeline for d1wiob4: