SCOPe 2.04: Domain d3t2ua1: 3t2u A:1-77

Lineage for d3t2ua1 (3t2u A:1-77)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Wuchereria bancrofti [TaxId:6293] [226429] (1 PDB entry)

8. Domain d3t2ua1: 3t2u A:1-77 [216650]
   Other proteins in same PDB: d3t2ua2, d3t2ub2
   automated match to d1tu7a2
   complexed with gsh

Details for d3t2ua1

PDB Entry: 3t2u, 2.3 Å

PDB Description: structure of wuchereria bancrofti pi-class glutathione s-transferase

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3t2ua1:

Sequence; same for both SEQRES and ATOM records:

>d3t2ua1 c.47.1.0 (A:1-77) automated matches {Wuchereria bancrofti [TaxId: 6293]}
msykltyfpirglaepirlvlvdqgikftddrinasdwpsmkshfhfgqlpclydgdhqi
vqsgailrhlarkhnln

Timeline for d3t2ua1:

• d3t2ua1 first appeared in SCOPe 2.03
  
• d3t2ua1 last appears in SCOPe 2.05