Lineage for d3svsd_ (3svs D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643577Protein automated matches [190406] (14 species)
    not a true protein
  7. 1643585Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)
  8. 1643593Domain d3svsd_: 3svs D: [216574]
    automated match to d3svod_
    mutant

Details for d3svsd_

PDB Entry: 3svs (more details), 1.74 Å

PDB Description: Crystal structure of mkate mutant S158A/S143C at pH 4.0
PDB Compounds: (D:) mkate S158A/S143C

SCOPe Domain Sequences for d3svsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svsd_ d.22.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
alitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrskk
paknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpskl

SCOPe Domain Coordinates for d3svsd_:

Click to download the PDB-style file with coordinates for d3svsd_.
(The format of our PDB-style files is described here.)

Timeline for d3svsd_: