Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Artificial gene [TaxId:32630] [189424] (7 PDB entries) |
Domain d3svrc_: 3svr C: [216569] automated match to d3svod_ mutant |
PDB Entry: 3svr (more details), 1.91 Å
SCOPe Domain Sequences for d3svrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3svrc_ d.22.1.1 (C:) automated matches {Artificial gene [TaxId: 32630]} salitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilats fmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvki rgvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrsk kpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk
Timeline for d3svrc_: