SCOPe 2.07: Domain d3stmx1: 3stm X:2-127

Lineage for d3stmx1 (3stm X:2-127)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries)
   Uniprot P07148 1-127

8. Domain d3stmx1: 3stm X:2-127 [216557]
   Other proteins in same PDB: d3stmx2
   automated match to d3vg7a_
   complexed with plm

Details for d3stmx1

PDB Entry: 3stm, 2.22 Å

PDB Description: structure of human lfabp in complex with one molecule of palmitic acid

PDB Compounds: (X:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d3stmx1:

Sequence; same for both SEQRES and ATOM records:

>d3stmx1 b.60.1.2 (X:2-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
sfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviqn
eftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivfk
riskri

Timeline for d3stmx1:

• d3stmx1 first appeared in SCOPe 2.03, called d3stmx_
  
• d3stmx1 appears in SCOPe 2.06
  
• d3stmx1 appears in the current release, SCOPe 2.08