![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Liver fatty acid binding protein [50866] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries) Uniprot P07148 1-127 |
![]() | Domain d3stmx1: 3stm X:2-127 [216557] Other proteins in same PDB: d3stmx2 automated match to d3vg7a_ complexed with plm |
PDB Entry: 3stm (more details), 2.22 Å
SCOPe Domain Sequences for d3stmx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stmx1 b.60.1.2 (X:2-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} sfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviqn eftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivfk riskri
Timeline for d3stmx1: