Lineage for d1vcaa1 (1vca A:91-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753547Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 2753548Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)
  8. 2753549Domain d1vcaa1: 1vca A:91-199 [21649]
    Other proteins in same PDB: d1vcaa2, d1vcab2
    D2

Details for d1vcaa1

PDB Entry: 1vca (more details), 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution
PDB Compounds: (A:) human vascular cell adhesion molecule-1

SCOPe Domain Sequences for d1vcaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvyisp

SCOPe Domain Coordinates for d1vcaa1:

Click to download the PDB-style file with coordinates for d1vcaa1.
(The format of our PDB-style files is described here.)

Timeline for d1vcaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcaa2