Lineage for d3sk3b2 (3sk3 B:200-400)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606444Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)
  8. 1606448Domain d3sk3b2: 3sk3 B:200-400 [216428]
    automated match to d1g99a2
    complexed with cit, edo

Details for d3sk3b2

PDB Entry: 3sk3 (more details), 1.9 Å

PDB Description: Crystal structure of Salmonella typhimurium acetate kinase (AckA) with citrate bound at the dimeric interface
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d3sk3b2:

Sequence, based on SEQRES records: (download)

>d3sk3b2 c.55.1.0 (B:200-400) automated matches {Salmonella enterica [TaxId: 90371]}
pveelniitchlgnggsvsairngkcvdtsmgltpleglvmgtrsgdidpaiifhlhdtl
gmsvdqinkmltkesgllgltevtsdcryvednyatkedakramdvychrlakyigsyta
lmdgrldavvftggigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrp
avviptneelviaqdasrlta

Sequence, based on observed residues (ATOM records): (download)

>d3sk3b2 c.55.1.0 (B:200-400) automated matches {Salmonella enterica [TaxId: 90371]}
pveelniitchlgnggsvsairngkcvdtsmgltpleglvmgtrsgdidpaiifhlhdtl
gmsvdlgltevtsdcryvednyatkedakramdvychrlakyigsytalmdgrldavvft
ggigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrpavviptneelvi
aqdasrlta

SCOPe Domain Coordinates for d3sk3b2:

Click to download the PDB-style file with coordinates for d3sk3b2.
(The format of our PDB-style files is described here.)

Timeline for d3sk3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sk3b1