Lineage for d3sh0a_ (3sh0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393538Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 1393539Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 1393540Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 1393541Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 1393545Species Escherichia coli [TaxId:562] [64009] (13 PDB entries)
  8. 1393550Domain d3sh0a_: 3sh0 A: [216412]
    automated match to d1ueha_
    complexed with sax

Details for d3sh0a_

PDB Entry: 3sh0 (more details), 1.84 Å

PDB Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1065
PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3sh0a_:

Sequence, based on SEQRES records: (download)

>d3sh0a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records): (download)

>d3sh0a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsfvwal
dsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivq
gvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
lyftdvlwpdfdeqdfegalnafanr

SCOPe Domain Coordinates for d3sh0a_:

Click to download the PDB-style file with coordinates for d3sh0a_.
(The format of our PDB-style files is described here.)

Timeline for d3sh0a_: