Lineage for d3s4yb2 (3s4y B:159-242)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1331907Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) (S)
  5. 1331908Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)
  6. 1331909Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)
  7. 1331913Species Human (Homo sapiens) [TaxId:9606] [226155] (1 PDB entry)
  8. 1331915Domain d3s4yb2: 3s4y B:159-242 [216210]
    Other proteins in same PDB: d3s4ya1, d3s4yb1
    automated match to d1ig3a1
    complexed with ca, so4, tpp, unx

Details for d3s4yb2

PDB Entry: 3s4y (more details), 1.8 Å

PDB Description: crystal structure of human thiamin pyrophosphokinase 1
PDB Compounds: (B:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d3s4yb2:

Sequence, based on SEQRES records: (download)

>d3s4yb2 b.82.6.1 (B:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
esliyllqpgkhrlhvdtgmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvsts
ntydgsgvvtvetdhpllwtmaik

Sequence, based on observed residues (ATOM records): (download)

>d3s4yb2 b.82.6.1 (B:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
esliyllqpgkhrlhvmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsnty
dgsgvvtvetdhpllwtmaik

SCOPe Domain Coordinates for d3s4yb2:

Click to download the PDB-style file with coordinates for d3s4yb2.
(The format of our PDB-style files is described here.)

Timeline for d3s4yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s4yb1