Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) |
Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein) |
Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [226155] (1 PDB entry) |
Domain d3s4yb2: 3s4y B:159-242 [216210] Other proteins in same PDB: d3s4ya1, d3s4yb1 automated match to d1ig3a1 complexed with ca, so4, tpp, unx |
PDB Entry: 3s4y (more details), 1.8 Å
SCOPe Domain Sequences for d3s4yb2:
Sequence, based on SEQRES records: (download)
>d3s4yb2 b.82.6.1 (B:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]} esliyllqpgkhrlhvdtgmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvsts ntydgsgvvtvetdhpllwtmaik
>d3s4yb2 b.82.6.1 (B:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]} esliyllqpgkhrlhvmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsnty dgsgvvtvetdhpllwtmaik
Timeline for d3s4yb2: