Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [226798] (1 PDB entry) |
Domain d3s42a1: 3s42 A:1-252 [216197] Other proteins in same PDB: d3s42a2, d3s42b2 automated match to d4h3dd_ complexed with bo3, dms, imd, mla, ni |
PDB Entry: 3s42 (more details), 1.45 Å
SCOPe Domain Sequences for d3s42a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s42a1 c.1.10.0 (A:1-252) automated matches {Salmonella enterica [TaxId: 90371]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva dlrtvltilhqa
Timeline for d3s42a1: