Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries) |
Domain d3rxxa_: 3rxx A: [216112] automated match to d3g32a_ complexed with npb |
PDB Entry: 3rxx (more details), 1.62 Å
SCOPe Domain Sequences for d3rxxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rxxa_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} nlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsqqq aglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpag ltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqqf vdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytrap nkddkhseaviaaaarlaleglg
Timeline for d3rxxa_: