![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [49135] (3 PDB entries) |
![]() | Domain d1bx2b1: 1bx2 B:93-193 [21610] Other proteins in same PDB: d1bx2a2, d1bx2b2, d1bx2d2, d1bx2e2 |
PDB Entry: 1bx2 (more details), 2.6 Å
SCOP Domain Sequences for d1bx2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx2b1 b.1.1.2 (B:93-193) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} rrvqpkvtvypsktqplqhhnllvcsvsgfypgsievrwflngqeekagmvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewrarse
Timeline for d1bx2b1: