Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries) |
Domain d1dlhb1: 1dlh B:93-190 [21598] Other proteins in same PDB: d1dlha2, d1dlhb2, d1dlhd2, d1dlhe2 |
PDB Entry: 1dlh (more details), 2.8 Å
SCOP Domain Sequences for d1dlhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlhb1 b.1.1.2 (B:93-190) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d1dlhb1: