SCOPe 2.04: Domain d3rjpa_: 3rjp A:

Lineage for d3rjpa_ (3rjp A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (12 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [226362] (1 PDB entry)

8. Domain d3rjpa_: 3rjp A: [215897]
   automated match to d1gxpb_

Details for d3rjpa_

PDB Entry: 3rjp, 1.5 Å

PDB Description: Crystal structure of the DNA binding domain of CovR from Streptococcus pyogenes

PDB Compounds: (A:) CovR

SCOPe Domain Sequences for d3rjpa_:

Sequence; same for both SEQRES and ATOM records:

>d3rjpa_ a.4.6.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
myrdlvlnpqnrsvnrgddeisltkreydllnilmtnmnrvmtreellsnvwkydeavet
nvvdvyirylrgkidipgkesyiqtvrgmgyvirek

Timeline for d3rjpa_:

• d3rjpa_ first appeared in SCOPe 2.03
  
• d3rjpa_ appears in SCOPe 2.05
  
• d3rjpa_ appears in the current release, SCOPe 2.08