Lineage for d3rite1 (3rit E:1-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555223Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)
  8. 2555228Domain d3rite1: 3rit E:1-125 [215863]
    Other proteins in same PDB: d3rita2, d3ritb2, d3ritc2, d3ritd2, d3rite2
    automated match to d1jpma2
    complexed with 1pe, arg, dly, mg, so4

Details for d3rite1

PDB Entry: 3rit (more details), 2.7 Å

PDB Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg and dipeptide L-Arg-D-Lys
PDB Compounds: (E:) Dipeptide Epimerase

SCOPe Domain Sequences for d3rite1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rite1 d.54.1.0 (E:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

SCOPe Domain Coordinates for d3rite1:

Click to download the PDB-style file with coordinates for d3rite1.
(The format of our PDB-style files is described here.)

Timeline for d3rite1: