Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries) |
Domain d1fyte2: 1fyt E:119-246 [21573] Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1 |
PDB Entry: 1fyt (more details), 2.6 Å
SCOP Domain Sequences for d1fyte2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyte2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain} dlnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d1fyte2: