Lineage for d3r1zb2 (3r1z B:128-357)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446123Species Francisella philomiragia [TaxId:484022] [226098] (5 PDB entries)
  8. 2446125Domain d3r1zb2: 3r1z B:128-357 [215538]
    Other proteins in same PDB: d3r1za1, d3r1za3, d3r1za4, d3r1zb1, d3r1zb3, d3r1zb4
    automated match to d1wufa1
    complexed with ala, dgl, glu, gol, so4

Details for d3r1zb2

PDB Entry: 3r1z (more details), 1.9 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Complex with L-Ala-L-Glu and L-Ala-D-Glu
PDB Compounds: (B:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r1zb2 c.1.11.0 (B:128-357) automated matches {Francisella philomiragia [TaxId: 484022]}
kansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefskni
kfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvades
vfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagila
tasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnl

SCOPe Domain Coordinates for d3r1zb2:

Click to download the PDB-style file with coordinates for d3r1zb2.
(The format of our PDB-style files is described here.)

Timeline for d3r1zb2: