Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Francisella philomiragia [TaxId:484022] [226098] (5 PDB entries) |
Domain d3r1zb2: 3r1z B:128-357 [215538] Other proteins in same PDB: d3r1za1, d3r1za3, d3r1za4, d3r1zb1, d3r1zb3, d3r1zb4 automated match to d1wufa1 complexed with ala, dgl, glu, gol, so4 |
PDB Entry: 3r1z (more details), 1.9 Å
SCOPe Domain Sequences for d3r1zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r1zb2 c.1.11.0 (B:128-357) automated matches {Francisella philomiragia [TaxId: 484022]} kansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefskni kfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvades vfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagila tasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnl
Timeline for d3r1zb2:
View in 3D Domains from other chains: (mouse over for more information) d3r1za1, d3r1za2, d3r1za3, d3r1za4 |