Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries) |
Domain d3r0kb1: 3r0k B:3-127 [215509] Other proteins in same PDB: d3r0ka2, d3r0ka3, d3r0ka4, d3r0kb2, d3r0kb3, d3r0kb4 automated match to d1wufa2 complexed with gol, so4, tar |
PDB Entry: 3r0k (more details), 2 Å
SCOPe Domain Sequences for d3r0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r0kb1 d.54.1.0 (B:3-127) automated matches {Francisella philomiragia [TaxId: 484022]} skiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtlq gmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisva kllga
Timeline for d3r0kb1:
View in 3D Domains from other chains: (mouse over for more information) d3r0ka1, d3r0ka2, d3r0ka3, d3r0ka4 |