Lineage for d3r0kb1 (3r0k B:3-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555135Species Francisella philomiragia [TaxId:484022] [226097] (5 PDB entries)
  8. 2555145Domain d3r0kb1: 3r0k B:3-127 [215509]
    Other proteins in same PDB: d3r0ka2, d3r0ka3, d3r0ka4, d3r0kb2, d3r0kb3, d3r0kb4
    automated match to d1wufa2
    complexed with gol, so4, tar

Details for d3r0kb1

PDB Entry: 3r0k (more details), 2 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Tartrate bound, no Mg
PDB Compounds: (B:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r0kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0kb1 d.54.1.0 (B:3-127) automated matches {Francisella philomiragia [TaxId: 484022]}
skiidiktsiikiplkrtfitavrstnhidslaveltldngvkgygvapattaitgdtlq
gmqyiireifapvilgsdlsdykqtlelafkkvmfnsaakmaidlayhdllakeqdisva
kllga

SCOPe Domain Coordinates for d3r0kb1:

Click to download the PDB-style file with coordinates for d3r0kb1.
(The format of our PDB-style files is described here.)

Timeline for d3r0kb1: