Lineage for d3qpkb2 (3qpk B:163-343)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303317Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 1303318Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (8 PDB entries)
  8. 1303347Domain d3qpkb2: 3qpk B:163-343 [215347]
    automated match to d1gw0a2
    complexed with cl, cu, nag, so4, xe

Details for d3qpkb2

PDB Entry: 3qpk (more details), 1.9 Å

PDB Description: probing oxygen channels in melanocarpus albomyces laccase
PDB Compounds: (B:) Laccase-1

SCOPe Domain Sequences for d3qpkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpkb2 b.6.1.3 (B:163-343) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
ydidlgvfpitdyyyraaddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpg
krhrlrilntstenhfqvslvnhtmtviaadmvpvnamtvdslflavgqrydvvidasra
pdnywfnvtfggqaacggslnphpaaifhyagapgglptdegtppvdhqcldtldvrpvv
p

SCOPe Domain Coordinates for d3qpkb2:

Click to download the PDB-style file with coordinates for d3qpkb2.
(The format of our PDB-style files is described here.)

Timeline for d3qpkb2: