Lineage for d3qibd1 (3qib D:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760564Domain d3qibd1: 3qib D:2-116 [215246]
    Other proteins in same PDB: d3qiba1, d3qiba2, d3qibb1, d3qibb2, d3qibc2, d3qibd2
    automated match to d1qrne1
    complexed with bma, fuc, nag, peg

Details for d3qibd1

PDB Entry: 3qib (more details), 2.7 Å

PDB Description: crystal structure of the 2b4 tcr in complex with mcc/i-ek
PDB Compounds: (D:) 2B4 beta chain

SCOPe Domain Sequences for d3qibd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qibd1 b.1.1.0 (D:2-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
ekrfsaecpsnspcsleiqsseagdsalylcasslnwsqdtqyfgpgtrllvled

SCOPe Domain Coordinates for d3qibd1:

Click to download the PDB-style file with coordinates for d3qibd1.
(The format of our PDB-style files is described here.)

Timeline for d3qibd1: