SCOPe 2.07: Domain d3q4ta1: 3q4t A:191-484

Lineage for d3q4ta1 (3q4t A:191-484)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d3q4ta1: 3q4t A:191-484 [215056]
   Other proteins in same PDB: d3q4ta2, d3q4tb2
   automated match to d2qlua_
   complexed with edo, pg4, so4, tak

Details for d3q4ta1

PDB Entry: 3q4t, 1.96 Å

PDB Description: Crystal structure of Activin receptor type-IIA (ACVR2A) kinase domain in complex with dorsomorphin

PDB Compounds: (A:) Activin receptor type-2A

SCOPe Domain Sequences for d3q4ta1:

Sequence; same for both SEQRES and ATOM records:

>d3q4ta1 d.144.1.0 (A:191-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plqllevkargrfgcvwkaqllneyvavkifpiqdkqswqneyevyslpgmkhenilqfi
gaekrgtsvdvdlwlitafhekgslsdflkanvvswnelchiaetmarglaylhedipgl
kdghkpaishrdiksknvllknnltaciadfglalkfeagksagdthgqvgtrrymapev
legainfqrdaflridmyamglvlwelasrctaadgpvdeymlpfeeeigqhpsledmqe
vvvhkkkrpvlrdywqkhagmamlcetieecwdhdaearlsagcvgeritqmqr

Timeline for d3q4ta1:

• d3q4ta1 first appeared in SCOPe 2.03, called d3q4ta_
  
• d3q4ta1 appears in SCOPe 2.06
  
• d3q4ta1 appears in the current release, SCOPe 2.08