Lineage for d3q28a_ (3q28 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522155Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries)
  8. 2522181Domain d3q28a_: 3q28 A: [215037]
    automated match to d1eu8a_
    complexed with mal, so4

Details for d3q28a_

PDB Entry: 3q28 (more details), 1.6 Å

PDB Description: cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (mbp)
PDB Compounds: (A:) Maltose-binding periplasmic protein/alpha-synuclein chimeric protein

SCOPe Domain Sequences for d3q28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q28a_ c.94.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
alkdaqtnsssktkeqvtnvggavvt

SCOPe Domain Coordinates for d3q28a_:

Click to download the PDB-style file with coordinates for d3q28a_.
(The format of our PDB-style files is described here.)

Timeline for d3q28a_: