Lineage for d3q1ld1 (3q1l D:2-127,D:330-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348180Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1348223Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1348254Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (11 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 1348284Domain d3q1ld1: 3q1l D:2-127,D:330-357 [215035]
    Other proteins in same PDB: d3q1la2, d3q1lb2, d3q1lc2, d3q1ld2
    automated match to d2gyya1
    complexed with dhl

Details for d3q1ld1

PDB Entry: 3q1l (more details), 2.3 Å

PDB Description: Crystals Structure of Aspartate beta-Semialdehyde Dehydrogenase from Streptococcus pneumoniae with cysteamine bound covalently to Cys 128
PDB Compounds: (D:) Aspartate beta-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3q1ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q1ld1 c.2.1.3 (D:2-127,D:330-357) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfel

SCOPe Domain Coordinates for d3q1ld1:

Click to download the PDB-style file with coordinates for d3q1ld1.
(The format of our PDB-style files is described here.)

Timeline for d3q1ld1: