Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
Protein automated matches [191110] (11 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [226045] (1 PDB entry) |
Domain d3q0ia1: 3q0i A:4-207 [215011] Other proteins in same PDB: d3q0ia2 automated match to d1fmta2 complexed with gol, so4 |
PDB Entry: 3q0i (more details), 1.89 Å
SCOPe Domain Sequences for d3q0ia1:
Sequence, based on SEQRES records: (download)
>d3q0ia1 c.65.1.0 (A:4-207) automated matches {Vibrio cholerae [TaxId: 666]} slrivfagtpdfaarhlaallsseheiiavytqperpagrgkkltaspvktlalehnvpv yqpenfksdeskqqlaalnadlmvvvayglllpkvvldtpklgcinvhgsilprwrgaap iqrsiwagdsetgvtimqmdvgldtgdmlkiatlpieasdtsasmydklaelgpqallec lqdiaqgtavavkqddglanyahk
>d3q0ia1 c.65.1.0 (A:4-207) automated matches {Vibrio cholerae [TaxId: 666]} slrivfagtpdfaarhlaallsseheiiavytqpetaspvktlalehnvpvyqpenfksd eskqqlaalnadlmvvvayglllpkvvldtpklgcinvhgsilprwrgaapiqrsiwagd setgvtimqmdvgldtgdmlkiatlpieasdtsasmydklaelgpqalleclqdiaqgta vavkqddglanyahk
Timeline for d3q0ia1: