Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Yersinia pestis [TaxId:632] [226052] (4 PDB entries) |
Domain d3oytb1: 3oyt B:1-252 [214597] automated match to d1ox0a1 complexed with edo, k, peg, pg4, pge, po4 |
PDB Entry: 3oyt (more details), 1.84 Å
SCOPe Domain Sequences for d3oytb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oytb1 c.95.1.0 (B:1-252) automated matches {Yersinia pestis [TaxId: 632]} mkravitglgivssignnqqevlaslqegrsgitfaqefkdagmrshvwgdvklqsepkd lidrkvlrfmsdasiyaylamqeaiadsglsdsqvsnfrsglvvgsgggsprnqvagsda mrtprglkgvgpymvtkamasgvsaclatpfkikgvnysissacatsahcighaleliql gkqdivfagggeelcwemacefdamgalstkyndtpakasrtydqdrdgfviaggggmvv veelehalarga
Timeline for d3oytb1: