SCOPe 2.04: Domain d3ordb_: 3ord B:

Lineage for d3ordb_ (3ord B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d3ordb_: 3ord B: [214481]
   automated match to d1ew6a_
   complexed with hem, so4, xe

Details for d3ordb_

PDB Entry: 3ord, 2.22 Å

PDB Description: Structural Evidence for Stabilization of Inhibitor Binding by a Protein Cavity in the Dehaloperoxidase-Hemoglobin from Amphitrite ornata

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3ordb_:

Sequence; same for both SEQRES and ATOM records:

>d3ordb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3ordb_:

• d3ordb_ first appeared in SCOPe 2.03
  
• d3ordb_ appears in SCOPe 2.05
  
• d3ordb_ appears in the current release, SCOPe 2.08