Lineage for d3opma2 (3opm A:509-766)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509714Species Human (Homo sapiens) [TaxId:9606] [188340] (94 PDB entries)
  8. 2509885Domain d3opma2: 3opm A:509-766 [214465]
    Other proteins in same PDB: d3opma1, d3opmb1, d3opmb3, d3opmc1, d3opmd1
    automated match to d1orva2
    complexed with lui, nag

Details for d3opma2

PDB Entry: 3opm (more details), 2.72 Å

PDB Description: crystal structure of human dpp4 bound to tak-294
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3opma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opma2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3opma2:

Click to download the PDB-style file with coordinates for d3opma2.
(The format of our PDB-style files is described here.)

Timeline for d3opma2: