Lineage for d3olga2 (3olg A:404-496)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555683Protein Animal alpha-amylase [51024] (3 species)
  7. 1555684Species Human (Homo sapiens) [TaxId:9606] [51026] (47 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 1555730Domain d3olga2: 3olg A:404-496 [214433]
    Other proteins in same PDB: d3olga1
    automated match to d1jfha1
    complexed with ca, cl, glc, hsd, pca, so4

Details for d3olga2

PDB Entry: 3olg (more details), 2.3 Å

PDB Description: structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3olga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olga2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d3olga2:

Click to download the PDB-style file with coordinates for d3olga2.
(The format of our PDB-style files is described here.)

Timeline for d3olga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3olga1