Lineage for d3o1na_ (3o1n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445182Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries)
  8. 2445183Domain d3o1na_: 3o1n A: [214119]
    automated match to d4h3dd_
    complexed with cl, mg; mutant

Details for d3o1na_

PDB Entry: 3o1n (more details), 1.03 Å

PDB Description: 1.03 angstrom crystal structure of q236a mutant type i dehydroquinate dehydratase (arod) from salmonella typhimurium
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3o1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o1na_ c.1.10.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgaisva
dlrtvltilhqa

SCOPe Domain Coordinates for d3o1na_:

Click to download the PDB-style file with coordinates for d3o1na_.
(The format of our PDB-style files is described here.)

Timeline for d3o1na_: