Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Mouse (Mus musculus) [TaxId:10090] [57212] (11 PDB entries) |
Domain d3ntga1: 3ntg A:18-58 [214045] Other proteins in same PDB: d3ntga2, d3ntgb2, d3ntgc2, d3ntgd2 automated match to d1ddxa2 complexed with bog, d72, hem, nag |
PDB Entry: 3ntg (more details), 2.19 Å
SCOPe Domain Sequences for d3ntga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntga1 g.3.11.1 (A:18-58) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d3ntga1: