![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries) |
![]() | Domain d3nnta1: 3nnt A:1-251 [214016] Other proteins in same PDB: d3nnta2, d3nntb2 automated match to d4h3dd_ complexed with dqa; mutant |
PDB Entry: 3nnt (more details), 1.6 Å
SCOPe Domain Sequences for d3nnta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nnta1 c.1.10.0 (A:1-251) automated matches {Salmonella enterica [TaxId: 99287]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipmiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva dlrtvltilhq
Timeline for d3nnta1: