Lineage for d3nnsb_ (3nns B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464408Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. 2464416Domain d3nnsb_: 3nns B: [214015]
    automated match to d1mvoa_
    complexed with bef, mg

Details for d3nnsb_

PDB Entry: 3nns (more details), 1.9 Å

PDB Description: BeF3 Activated DrrB Receiver Domain
PDB Compounds: (B:) DNA binding response regulator b

SCOPe Domain Sequences for d3nnsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nnsb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgye
icrmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrfler

SCOPe Domain Coordinates for d3nnsb_:

Click to download the PDB-style file with coordinates for d3nnsb_.
(The format of our PDB-style files is described here.)

Timeline for d3nnsb_: