Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Glutamate dehydrogenase [51884] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [51889] (8 PDB entries) |
Domain d3mvqc2: 3mvq C:209-495 [213600] Other proteins in same PDB: d3mvqa1, d3mvqb1, d3mvqc1, d3mvqd1, d3mvqe1, d3mvqf1 automated match to d3mw9a1 complexed with glu, gtp, ndp, zn |
PDB Entry: 3mvq (more details), 2.94 Å
SCOPe Domain Sequences for d3mvqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvqc2 c.2.1.7 (C:209-495) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga kcitvgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlnn lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyne
Timeline for d3mvqc2: