Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [225811] (3 PDB entries) |
Domain d3mpya_: 3mpy A: [213555] automated match to d2a10b_ complexed with so4 |
PDB Entry: 3mpy (more details), 2 Å
SCOPe Domain Sequences for d3mpya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpya_ d.58.56.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa aaqrigelvsvhviprphgdleevfpiglkgdssnl
Timeline for d3mpya_: