Lineage for d3mkpa1 (3mkp A:36-126)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637806Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 2637807Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 2637808Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 2637858Protein automated matches [191160] (2 species)
    not a true protein
  7. 2637859Species Human (Homo sapiens) [TaxId:9606] [225941] (1 PDB entry)
  8. 2637860Domain d3mkpa1: 3mkp A:36-126 [213300]
    Other proteins in same PDB: d3mkpa2, d3mkpb2, d3mkpc2, d3mkpd2
    automated match to d1bhta1
    complexed with epe, sgn, so4; mutant

Details for d3mkpa1

PDB Entry: 3mkp (more details), 2.81 Å

PDB Description: crystal structure of 1k1 mutant of hepatocyte growth factor/scatter factor fragment nk1 in complex with heparin
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d3mkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mkpa1 g.10.1.1 (A:36-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

SCOPe Domain Coordinates for d3mkpa1:

Click to download the PDB-style file with coordinates for d3mkpa1.
(The format of our PDB-style files is described here.)

Timeline for d3mkpa1: